PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G180000.2
Common NameB456_004G180000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 279aa    MW: 31458.2 Da    PI: 9.7014
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G180000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-322579155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Gorai.004G180000.2 25 KPRLRWTADLHDRFVDAVTKLGGPNKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 79
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8472282IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-312280IPR009057Homeodomain-like
SuperFamilySSF466893.23E-162582IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-242580IPR006447Myb domain, plants
PfamPF002498.2E-92778IPR001005SANT/Myb domain
PfamPF143793.6E-22123170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MERLSYGGNG NYGYENGVVM TRDPKPRLRW TADLHDRFVD AVTKLGGPNK ATPKSVLRLM  60
GLKGLTLYHL KSHLQKYRLG QQSRKQNTAD QNKENGSSYV QFSNHSSGTV TNSPRADDDK  120
RQIQMTEVLK SQMEVQKTLQ EQLEVQKKLQ MRIEAQGKYL QAILEKAQKS LSFDIHSEEN  180
VEEKRAQLTN FNLPLSSLMD STNEADRKSN MAQMNDVIPT KANFSASFHG HGVGDREENK  240
HVKRKVEGDS INFDLNTKDS NEYGAVNGNQ LQSHLVFS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5780824e-76JX578082.1 Gossypium hirsutum clone NBRI_GE10029 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475594.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
SwissprotQ9SAK54e-51APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D2S1M80.0A0A0D2S1M8_G
STRINGPOPTR_0001s01560.11e-100(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-69G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]